PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr038494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRAS
Protein Properties Length: 543aa    MW: 60640.6 Da    PI: 6.3767
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr038494.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS422.63.3e-1291735422374
         GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                  +++Ll cA+a+s++dl  a++ ++ l +++s +g+pmqRl ay++e+L+a+l rs+s +ykal+++  +   ss+ +++++++++++P+ kf+++ aN
  Pbr038494.1 173 KDVLLYCAHAISEDDLYTATSWMEVLGQMVSVSGEPMQRLGAYMLEGLRAKLERSGSLIYKALKCEVPT---SSQLMSYMSVLYDICPYWKFAYVSAN 267
                  789*****************************************************************9...999999******************** PP

         GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLr 195
                    I ea+e+e  +HiiDf+i qG QW++L+q La Rp+gpp +RiTgv++ +s   +   l+ +gerL+k+A++++vpfefn+ +a+  +++el++Lr
  Pbr038494.1 268 VVIREALENEPIIHIIDFQIAQGSQWVPLIQDLARRPGGPPCIRITGVDDTQSAhaRGGGLHIVGERLSKLAASCNVPFEFNA-AARCGSQVELHNLR 364
                  **************************************************9988889999***********************.9************* PP

         GRAS 196 vkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgre 293
                  ++pgEa+aVn+ + lh+++desvs+e++rd++L+lvkslsPkv+++veqe+++n+++F+ rf+e ++yy+a+f+s+++  pr++++ri+ E+++++r+
  Pbr038494.1 365 IQPGEAIAVNFPYVLHHMPDESVSTENHRDRLLRLVKSLSPKVMTLVEQESNTNTSPFFSRFSEMVDYYTAMFESIDVARPRDDKQRINAEAHCVARD 462
                  ************************************************************************************************** PP

         GRAS 294 ivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                  ivn+vacegaer+erhe ++kWr+rl++ GF+++pls k+++ ++ ll++++++ +r++e +g+l+lgWk+r++v+ SaWr
  Pbr038494.1 463 IVNMVACEGAERVERHELFGKWRSRLMMDGFTQYPLSPKVTAAIRILLKEYNEN-FRIQEADGALYLGWKQRAMVTSSAWR 542
                  ****************************************************55.*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.188146523IPR005202Transcription factor GRAS
PfamPF035141.1E-126173542IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MKTSQQHRGV ASIHHKLYHP PVQQIDAYGY QILENSVFPD TGSQGNNVSF QTCKDGEEQF  60
FTLESSPATA FVTCDSPSAV SSLSNKSPFS PQGSHSCLSD QHHSSGNNYG SPTSGCSVVE  120
DDNEFKYRLR EVEVSLLGPD SDIVDSHFCC HKSGMARWSQ SQIATMIPKL NLKDVLLYCA  180
HAISEDDLYT ATSWMEVLGQ MVSVSGEPMQ RLGAYMLEGL RAKLERSGSL IYKALKCEVP  240
TSSQLMSYMS VLYDICPYWK FAYVSANVVI REALENEPII HIIDFQIAQG SQWVPLIQDL  300
ARRPGGPPCI RITGVDDTQS AHARGGGLHI VGERLSKLAA SCNVPFEFNA AARCGSQVEL  360
HNLRIQPGEA IAVNFPYVLH HMPDESVSTE NHRDRLLRLV KSLSPKVMTL VEQESNTNTS  420
PFFSRFSEMV DYYTAMFESI DVARPRDDKQ RINAEAHCVA RDIVNMVACE GAERVERHEL  480
FGKWRSRLMM DGFTQYPLSP KVTAAIRILL KEYNENFRIQ EADGALYLGW KQRAMVTSSA  540
WR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-541765428375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ3976380.0JQ397638.1 Malus zumi SCL mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009344952.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_009344953.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_009374874.10.0PREDICTED: scarecrow-like protein 13
RefseqXP_009374875.10.0PREDICTED: scarecrow-like protein 13
SwissprotQ9M0M50.0SCL13_ARATH; Scarecrow-like protein 13
TrEMBLA0A0U1VL410.0A0A0U1VL41_9R
STRINGGLYMA15G12320.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF43773360
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17230.10.0SCARECROW-like 13